PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C021987P2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family ZF-HD
Protein Properties Length: 110aa    MW: 11887.4 Da    PI: 8.0522
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C021987P2genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.65.2e-324095359
     ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                    +vrY eC+kNhAa +Gg+avDGC+Efm+s g+egt+a+l+CaACgCHRnFHRr+v +
  MELO3C021987P2 40 SVRYGECQKNHAAGVGGYAVDGCREFMAS-GDEGTTAGLTCAACGCHRNFHRRQVGT 95
                    79**************************9.999********************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-3214106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.9E-294192IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.6E-264292IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.5734392IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
MDLLLQFFFS LVQMRKRQVV LRRSEEPSRD TVASSFTVRS VRYGECQKNH AAGVGGYAVD  60
GCREFMASGD EGTTAGLTCA ACGCHRNFHR RQVGTEVVCD CSSSPSNGT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818890.0LN681889.1 Cucumis melo genomic scaffold, anchoredscaffold00051.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008459312.12e-65PREDICTED: mini zinc finger protein 2
RefseqXP_008459313.12e-65PREDICTED: mini zinc finger protein 2
SwissprotQ9LJW56e-44MIF2_ARATH; Mini zinc finger protein 2
TrEMBLA0A0A0KVJ71e-60A0A0A0KVJ7_CUCSA; Transcription factor
STRINGVIT_14s0108g00810.t011e-49(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF155034100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.13e-45mini zinc finger 2